PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g078310.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 291aa    MW: 31879.7 Da    PI: 6.9774
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g078310.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-3089142155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sopim10g078310.0.1  89 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 142
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-2086146IPR009057Homeodomain-like
PROSITE profilePS5129411.05986145IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-3088147IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-2490142IPR006447Myb domain, plants
PfamPF002491.1E-792141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPKPE ELMPLSQTLI TPDLAIAFDI PNPTSPNPQS KQQQTPHVQS  60
SQPNSSAEFE STELNGGGGG DEPARTLKRP RLVWTPQLHK RFVDAVAHLG IKNAVPKTIM  120
QLMSVDGLTR ENVASHLQKY RLYLKRMQGL SNSGSGGSNA QSLSGAGVDP AMDNLFASSP  180
VPAHFLHPGR GNSDHFMPFV PVTPMPHHHH MGVVVGHHPQ VQQQYRQFGS PANGHFEHPF  240
LSRQSQQQVQ RMGTSVHNGS PVVSSYVEDV DSATAVNGRK VLTLFPTGED *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2088147463ARR10-B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249126.10.0PREDICTED: transcription factor PCL1-like
RefseqXP_015056300.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB42e-51PCL1_ARATH; Transcription factor LUX
TrEMBLK4D2730.0K4D273_SOLLC; Uncharacterized protein
STRINGSolyc10g078310.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.17e-87G2-like family protein